PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc03g083880.2.1
Common NameLOC101247411
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 313aa    MW: 36453.7 Da    PI: 6.8364
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc03g083880.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.92.3e-5481352128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         ppGfrFhPtdeelv++yLkkk+++++++l +vikev++y++ePwdL++  ++   ee+ewyfFs++dkky+tg+r+nrat++g+Wkatg+d
  Solyc03g083880.2.1   8 PPGFRFHPTDEELVDYYLKKKITSTRIDL-DVIKEVNLYNIEPWDLQElcRIGReEEDEWYFFSHKDKKYPTGTRTNRATTAGFWKATGRD 97 
                         9****************************.9***************954544442555********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         k+v+s ++ l+g++ktLvfykgrap+g k+dW+mheyrl
  Solyc03g083880.2.1  98 KAVYS-NHDLIGMRKTLVFYKGRAPHGLKSDWIMHEYRL 135
                         *****.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.23E-615156IPR003441NAC domain
PROSITE profilePS5100558.9917156IPR003441NAC domain
PfamPF023653.6E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MNSFSQIPPG FRFHPTDEEL VDYYLKKKIT STRIDLDVIK EVNLYNIEPW DLQELCRIGR  60
EEEDEWYFFS HKDKKYPTGT RTNRATTAGF WKATGRDKAV YSNHDLIGMR KTLVFYKGRA  120
PHGLKSDWIM HEYRLHTDPN GAHQEEGWVV CRVFKKKMAS TRKESEKESP NNNDQVPFMP  180
NHIVSQHNYP CKKELIDNLN YQIQIPSHHH HHQQSPKLVP STSISVYNNL QQSVSLLTRE  240
QVVDQVTDWR VLHKFVASQL SQEEENDYYS NTLHGVTDES NLNKQETVTE NNSTASSCFQ  300
IDLGKYTSLF VD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-50715715169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004235093.10.0PREDICTED: NAC domain-containing protein 7
SwissprotQ9FWX21e-111NAC7_ARATH; NAC domain-containing protein 7
TrEMBLK4BIG30.0K4BIG3_SOLLC; Uncharacterized protein
STRINGSolyc03g083880.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62700.13e-97Arabidopsis NAC domain containing protein 26
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]